PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G27920.1
Common NameATGL1, ATMYB0, GL1, K16N12.17, MYB0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 228aa    MW: 26338.6 Da    PI: 7.1784
Description myb domain protein 0
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G27920.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.9e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd +l d+v  +G+g+W++I r+ g++R++k+c++rw +yl
      AT3G27920.1 16 KGLWTVEEDNILMDYVLNHGTGQWNRIVRKTGLKRCGKSCRLRWMNYL 63
                     678*******************************************97 PP

2Myb_DNA-binding60.73.2e-1969114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
      AT3G27920.1  69 KGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 114
                      79********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4461163IPR017930Myb domain
SuperFamilySSF466891.25E-3014110IPR009057Homeodomain-like
SMARTSM007172.2E-121565IPR001005SANT/Myb domain
PfamPF002499.2E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-231770IPR009057Homeodomain-like
CDDcd001671.26E-91963No hitNo description
PROSITE profilePS5129428.16864118IPR017930Myb domain
SMARTSM007177.9E-1968116IPR001005SANT/Myb domain
PfamPF002492.8E-1869114IPR001005SANT/Myb domain
CDDcd001674.82E-1471114No hitNo description
Gene3DG3DSA:1.10.10.609.3E-2871118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0032880Biological Processregulation of protein localization
GO:0048629Biological Processtrichome patterning
GO:2000039Biological Processregulation of trichome morphogenesis
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0009006anatomyshoot system
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MRIRRRDEKE NQEYKKGLWT VEEDNILMDY VLNHGTGQWN RIVRKTGLKR CGKSCRLRWM  60
NYLSPNVNKG NFTEQEEDLI IRLHKLLGNR WSLIAKRVPG RTDNQVKNYW NTHLSKKLVG  120
DYSSAVKTTG EDDDSPPSLF ITAATPSSCH HQQENIYENI AKSFNGVVSA SYEDKPKQEL  180
AQKDVLMATT NDPSHYYGNN ALWVHDDDFE LSSLVMMNFA SGDVEYCL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29161187108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible257221_at0.0
Expression AtlasAT3G27920-
AtGenExpressAT3G27920-
ATTED-IIAT3G27920-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Ubiquitous in young leaves primordia. Becomes more prominent in developing trichome cells but disappears progressively when trichomes begin to initiate branches. {ECO:0000269|PubMed:15728674}.
UniprotTISSUE SPECIFICITY: Expressed in leaves, stems and flowers. {ECO:0000269|PubMed:11437443}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a Myb-like protein that is required for induction of trichome development.
UniProtTranscription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in leaves. Together with TTG1 and GL3, promotes trichome formation and endoreplication. Regulates the production of a signal that induces hair (trichome) precursor cells on leaf primordia to differentiate. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes (By similarity). {ECO:0000250, ECO:0000269|PubMed:11063707, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15728674}.
Function -- GeneRIF ? help Back to Top
  1. TRICHOMELESS1 can be recruited to the cis-acting regulatory elements of GLABRA1
    [PMID: 17933793]
  2. Data show that GL1 associates with TRANSPARENT TESTA GLABRA1 in vivo, forming a complex.
    [PMID: 18434419]
  3. Expression levels of GL1, MYB23, GL2 and TTG1 were reduced in shoots of sad2 mutants while expression levels of GL3 and ENHANCER OF GLABRA3 (EGL3) were enhanced.
    [PMID: 18713401]
  4. DNA binding of GL1 and GL3 via their own DNA-binding domains to the promoter of GL2 is probably required for the activation of GL2 expression.
    [PMID: 18948276]
  5. 20 novel genes in the regulatory network involved in the trichome formation are the direct targets of GL3/GL1.
    [PMID: 19247443]
  6. Impaired fatty acid/lipid flux is associated with a nonallelic GLABRA1 mutation which causes abnormal cuticle formation and impaired plant immunity.
    [PMID: 20699396]
  7. GL1 has qualitative and likely quantitative effects on trichome density in natural populations of Arabidopsis thaliana.
    [PMID: 22625421]
  8. AtMYC1 protein is predominantly localised in the cytoplasm and can relocate GL1 from the nucleus into the cytoplasm.
    [PMID: 23900543]
  9. Protein interaction analysis revealed that MYB82 physically interacts with GLABRA3. In addition, MYB82 and GL1 can form homodimers and heterodimers at R2R3-MYB domains, which may explain why their overexpression reduces trichome numbers.
    [PMID: 24803498]
  10. GL1 represses the activation of the TRY promoter by GL3 and TTG1, and TTG1 suppresses the activation of the CPC promoter by GL1 and GL3.
    [PMID: 25926482]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G27920.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G14920 (R), AT2G01570 (A), AT2G30432 (R), AT3G58070 (A), AT5G06650 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G01380(A), AT1G79840(A), AT2G37260(A), AT2G46410(A), AT4G01060(A), AT5G53200(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDgibberellin, Jasmonic acid
Interaction -- BIND ? help Back to Top
Source Intact With Description
BINDAT1G63650EGL3 interacts with GL1.
BINDAT4G00480MYC1 (AtBHLH012) interacts with GL1.
BINDAT5G41315GL3 interacts with GL1.
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G27920, AT4G00480, AT5G40330, AT5G41315, AT5G52600, AT1G14920, AT1G63650
IntActSearch P27900
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G27920
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195900.0AY519590.1 Arabidopsis thaliana MYB transcription factor (At3g27920) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189430.11e-173trichome differentiation protein GL1
SwissprotP279001e-175GL1_ARATH; Trichome differentiation protein GL1
TrEMBLI6P6H31e-173I6P6H3_ARATH; Glabrous 1
STRINGAT3G27920.11e-173(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Larkin JC,Walker JD,Bolognesi-Winfield AC,Gray JC,Walker AR
    Allele-specific interactions between ttg and gl1 during trichome development in Arabidopsis thaliana.
    Genetics, 1999. 151(4): p. 1591-604
    [PMID:10101180]
  2. Nagata T, et al.
    Gamma-radiation induces leaf trichome formation in Arabidopsis.
    Plant Physiol., 1999. 120(1): p. 113-20
    [PMID:10318689]
  3. Schnittger A,Folkers U,Schwab B,J
    Generation of a spacing pattern: the role of triptychon in trichome patterning in Arabidopsis.
    Plant Cell, 1999. 11(6): p. 1105-16
    [PMID:10368181]
  4. Shikazono N,Tanaka A,Yokota Y,Watanabe H,Tano SM
    Nucleotide sequence of the GLABROUS1 gene of Arabidopsis thaliana ecotype Columbia.
    DNA Seq., 1998. 9(3): p. 177-81
    [PMID:10520748]
  5. Payne CT,Zhang F,Lloyd AM
    GL3 encodes a bHLH protein that regulates trichome development in arabidopsis through interaction with GL1 and TTG1.
    Genetics, 2000. 156(3): p. 1349-62
    [PMID:11063707]
  6. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  7. Shikazono N,Tanaka A,Watanabe H,Tano S
    Rearrangements of the DNA in carbon ion-induced mutants of Arabidopsis thaliana.
    Genetics, 2001. 157(1): p. 379-87
    [PMID:11139518]
  8. Lee MM,Schiefelbein J
    Developmentally distinct MYB genes encode functionally equivalent proteins in Arabidopsis.
    Development, 2001. 128(9): p. 1539-46
    [PMID:11290293]
  9. Kirik V, et al.
    Ectopic expression of the Arabidopsis AtMYB23 gene induces differentiation of trichome cells.
    Dev. Biol., 2001. 235(2): p. 366-77
    [PMID:11437443]
  10. Hauser MT,Harr B,Schl
    Trichome distribution in Arabidopsis thaliana and its close relative Arabidopsis lyrata: molecular analysis of the candidate gene GLABROUS1.
    Mol. Biol. Evol., 2001. 18(9): p. 1754-63
    [PMID:11504855]
  11. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  12. Sawa S
    Overexpression of the AtmybL2 gene represses trichome development in Arabidopsis.
    DNA Res., 2002. 9(2): p. 31-4
    [PMID:12056412]
  13. Larkin JC,Oppenheimer DG,Lloyd AM,Paparozzi ET,Marks MD
    Roles of the GLABROUS1 and TRANSPARENT TESTA GLABRA Genes in Arabidopsis Trichome Development.
    Plant Cell, 1994. 6(8): p. 1065-1076
    [PMID:12244266]
  14. Larkin JC,Oppenheimer DG,Pollock S,Marks MD
    Arabidopsis GLABROUS1 Gene Requires Downstream Sequences for Function.
    Plant Cell, 1993. 5(12): p. 1739-1748
    [PMID:12271054]
  15. Schellmann S, et al.
    TRIPTYCHON and CAPRICE mediate lateral inhibition during trichome and root hair patterning in Arabidopsis.
    EMBO J., 2002. 21(19): p. 5036-46
    [PMID:12356720]
  16. Marks MD,Feldmann KA
    Trichome Development in Arabidopsis thaliana. I. T-DNA Tagging of the GLABROUS1 Gene.
    Plant Cell, 1989. 1(11): p. 1043-1050
    [PMID:12359885]
  17. Herman PL,Marks MD
    Trichome Development in Arabidopsis thaliana. II. Isolation and Complementation of the GLABROUS1 Gene.
    Plant Cell, 1989. 1(11): p. 1051-1055
    [PMID:12359886]
  18. Schiefelbein J
    Cell-fate specification in the epidermis: a common patterning mechanism in the root and shoot.
    Curr. Opin. Plant Biol., 2003. 6(1): p. 74-8
    [PMID:12495754]
  19. Curaba J,Herzog M,Vachon G
    GeBP, the first member of a new gene family in Arabidopsis, encodes a nuclear protein with DNA-binding activity and is regulated by KNAT1.
    Plant J., 2003. 33(2): p. 305-17
    [PMID:12535344]
  20. Zhang F,Gonzalez A,Zhao M,Payne CT,Lloyd A
    A network of redundant bHLH proteins functions in all TTG1-dependent pathways of Arabidopsis.
    Development, 2003. 130(20): p. 4859-69
    [PMID:12917293]
  21. Kurata T, et al.
    The YORE-YORE gene regulates multiple aspects of epidermal cell differentiation in Arabidopsis.
    Plant J., 2003. 36(1): p. 55-66
    [PMID:12974811]
  22. Esch JJ, et al.
    A contradictory GLABRA3 allele helps define gene interactions controlling trichome development in Arabidopsis.
    Development, 2003. 130(24): p. 5885-94
    [PMID:14561633]
  23. Wang S, et al.
    Control of plant trichome development by a cotton fiber MYB gene.
    Plant Cell, 2004. 16(9): p. 2323-34
    [PMID:15316114]
  24. Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
    Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
    Plant J., 2004. 40(1): p. 22-34
    [PMID:15361138]
  25. Reymond P, et al.
    A conserved transcript pattern in response to a specialist and a generalist herbivore.
    Plant Cell, 2004. 16(11): p. 3132-47
    [PMID:15494554]
  26. Esch JJ,Chen MA,Hillestad M,Marks MD
    Comparison of TRY and the closely related At1g01380 gene in controlling Arabidopsis trichome patterning.
    Plant J., 2004. 40(6): p. 860-9
    [PMID:15584952]
  27. Kirik V, et al.
    Functional diversification of MYB23 and GL1 genes in trichome morphogenesis and initiation.
    Development, 2005. 132(7): p. 1477-85
    [PMID:15728674]
  28. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  29. Gruber MY, et al.
    "HAIRY CANOLA"--Arabidopsis GL3 induces a dense covering of trichomes on Brassica napus seedlings.
    Plant Mol. Biol., 2006. 60(5): p. 679-98
    [PMID:16649106]
  30. Gan Y, et al.
    GLABROUS INFLORESCENCE STEMS modulates the regulation by gibberellins of epidermal differentiation and shoot maturation in Arabidopsis.
    Plant Cell, 2006. 18(6): p. 1383-95
    [PMID:16679458]
  31. Calo L,Garc
    Leaf hairs influence phytopathogenic fungus infection and confer an increased resistance when expressing a Trichoderma alpha-1,3-glucanase.
    J. Exp. Bot., 2006. 57(14): p. 3911-20
    [PMID:17043085]
  32. Gan Y,Yu H,Peng J,Broun P
    Genetic and molecular regulation by DELLA proteins of trichome development in Arabidopsis.
    Plant Physiol., 2007. 145(3): p. 1031-42
    [PMID:17704233]
  33. Ishida T, et al.
    Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation.
    Plant Cell, 2007. 19(8): p. 2531-43
    [PMID:17766401]
  34. Morohashi K, et al.
    Participation of the Arabidopsis bHLH factor GL3 in trichome initiation regulatory events.
    Plant Physiol., 2007. 145(3): p. 736-46
    [PMID:17885086]
  35. Wang S, et al.
    TRICHOMELESS1 regulates trichome patterning by suppressing GLABRA1 in Arabidopsis.
    Development, 2007. 134(21): p. 3873-82
    [PMID:17933793]
  36. Marks MD,Esch J,Herman P,Sivakumaran S,Oppenheimer D
    A model for cell-type determination and differentiation in plants.
    Symp. Soc. Exp. Biol., 1991. 45: p. 77-87
    [PMID:1843415]
  37. Zhao M,Morohashi K,Hatlestad G,Grotewold E,Lloyd A
    The TTG1-bHLH-MYB complex controls trichome cell fate and patterning through direct targeting of regulatory loci.
    Development, 2008. 135(11): p. 1991-9
    [PMID:18434419]
  38. Wang S, et al.
    Comprehensive analysis of single-repeat R3 MYB proteins in epidermal cell patterning and their transcriptional regulation in Arabidopsis.
    BMC Plant Biol., 2008. 8: p. 81
    [PMID:18644155]
  39. Shangguan XX,Xu B,Yu ZX,Wang LJ,Chen XY
    Promoter of a cotton fibre MYB gene functional in trichomes of Arabidopsis and glandular trichomes of tobacco.
    J. Exp. Bot., 2008. 59(13): p. 3533-42
    [PMID:18711121]
  40. Gao Y, et al.
    SAD2 in Arabidopsis functions in trichome initiation through mediating GL3 function and regulating GL1, TTG1 and GL2 expression.
    J Integr Plant Biol, 2008. 50(7): p. 906-17
    [PMID:18713401]
  41. Digiuni S, et al.
    A competitive complex formation mechanism underlies trichome patterning on Arabidopsis leaves.
    Mol. Syst. Biol., 2008. 4: p. 217
    [PMID:18766177]
  42. Wang S,Chen JG
    Arabidopsis transient expression analysis reveals that activation of GLABRA2 may require concurrent binding of GLABRA1 and GLABRA3 to the promoter of GLABRA2.
    Plant Cell Physiol., 2008. 49(12): p. 1792-804
    [PMID:18948276]
  43. Li SF, et al.
    The Arabidopsis MYB5 transcription factor regulates mucilage synthesis, seed coat development, and trichome morphogenesis.
    Plant Cell, 2009. 21(1): p. 72-89
    [PMID:19136646]
  44. Yoshida Y,Sano R,Wada T,Takabayashi J,Okada K
    Jasmonic acid control of GLABRA3 links inducible defense and trichome patterning in Arabidopsis.
    Development, 2009. 136(6): p. 1039-48
    [PMID:19234066]
  45. Morohashi K,Grotewold E
    A systems approach reveals regulatory circuitry for Arabidopsis trichome initiation by the GL3 and GL1 selectors.
    PLoS Genet., 2009. 5(2): p. e1000396
    [PMID:19247443]
  46. Wester K, et al.
    Functional diversity of R3 single-repeat genes in trichome development.
    Development, 2009. 136(9): p. 1487-96
    [PMID:19336467]
  47. Oppenheimer DG,Herman PL,Sivakumaran S,Esch J,Marks MD
    A myb gene required for leaf trichome differentiation in Arabidopsis is expressed in stipules.
    Cell, 1991. 67(3): p. 483-93
    [PMID:1934056]
  48. Kang YH, et al.
    The MYB23 gene provides a positive feedback loop for cell fate specification in the Arabidopsis root epidermis.
    Plant Cell, 2009. 21(4): p. 1080-94
    [PMID:19395683]
  49. Marks MD,Wenger JP,Gilding E,Jilk R,Dixon RA
    Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development.
    Mol Plant, 2009. 2(4): p. 803-22
    [PMID:19626137]
  50. Wenger JP,Marks MD
    E2F and retinoblastoma related proteins may regulate GL1 expression in developing Arabidopsis trichomes.
    Plant Signal Behav, 2008. 3(6): p. 420-2
    [PMID:19704586]
  51. Siegal-Gaskins D,Grotewold E,Smith GD
    The capacity for multistability in small gene regulatory networks.
    BMC Syst Biol, 2009. 3: p. 96
    [PMID:19772572]
  52. Yu N, et al.
    Temporal control of trichome distribution by microRNA156-targeted SPL genes in Arabidopsis thaliana.
    Plant Cell, 2010. 22(7): p. 2322-35
    [PMID:20622149]
  53. Xia Y, et al.
    The glabra1 mutation affects cuticle formation and plant responses to microbes.
    Plant Physiol., 2010. 154(2): p. 833-46
    [PMID:20699396]
  54. Qi T, et al.
    The Jasmonate-ZIM-domain proteins interact with the WD-Repeat/bHLH/MYB complexes to regulate Jasmonate-mediated anthocyanin accumulation and trichome initiation in Arabidopsis thaliana.
    Plant Cell, 2011. 23(5): p. 1795-814
    [PMID:21551388]
  55. Symonds VV,Hatlestad G,Lloyd AM
    Natural allelic variation defines a role for ATMYC1: trichome cell fate determination.
    PLoS Genet., 2011. 7(6): p. e1002069
    [PMID:21695236]
  56. Guan X, et al.
    Activation of Arabidopsis seed hair development by cotton fiber-related genes.
    PLoS ONE, 2011. 6(7): p. e21301
    [PMID:21779324]
  57. Zhou Z, et al.
    Zinc finger protein5 is required for the control of trichome initiation by acting upstream of zinc finger protein8 in Arabidopsis.
    Plant Physiol., 2011. 157(2): p. 673-82
    [PMID:21803862]
  58. Kawagoe T,Shimizu KK,Kakutani T,Kudoh H
    Coexistence of trichome variation in a natural plant population: a combined study using ecological and candidate gene approaches.
    PLoS ONE, 2011. 6(7): p. e22184
    [PMID:21811571]
  59. Reisberg EE,Hildebrandt U,Riederer M,Hentschel U
    Phyllosphere bacterial communities of trichome-bearing and trichomeless Arabidopsis thaliana leaves.
    Antonie Van Leeuwenhoek, 2012. 101(3): p. 551-60
    [PMID:22080429]
  60. Valdivia ER, et al.
    DVL genes play a role in the coordination of socket cell recruitment and differentiation.
    J. Exp. Bot., 2012. 63(3): p. 1405-12
    [PMID:22112938]
  61. Gan L,Xia K,Chen JG,Wang S
    Functional characterization of TRICHOMELESS2, a new single-repeat R3 MYB transcription factor in the regulation of trichome patterning in Arabidopsis.
    BMC Plant Biol., 2011. 11: p. 176
    [PMID:22168948]
  62. Zhao X,Qiao XR,Yuan J,Ma XF,Zhang X
    Nitric oxide inhibits blue light-induced stomatal opening by regulating the K+ influx in guard cells.
    Plant Sci., 2012. 184: p. 29-35
    [PMID:22284707]
  63. Zhao H, et al.
    A single amino acid substitution in IIIf subfamily of basic helix-loop-helix transcription factor AtMYC1 leads to trichome and root hair patterning defects by abolishing its interaction with partner proteins in Arabidopsis.
    J. Biol. Chem., 2012. 287(17): p. 14109-21
    [PMID:22334670]
  64. Meyer RC, et al.
    Heterosis manifestation during early Arabidopsis seedling development is characterized by intermediate gene expression and enhanced metabolic activity in the hybrids.
    Plant J., 2012. 71(4): p. 669-83
    [PMID:22487254]
  65. Hirano T, et al.
    Molecular nature of mutations induced by high-LET irradiation with argon and carbon ions in Arabidopsis thaliana.
    Mutat. Res., 2012. 735(1-2): p. 19-31
    [PMID:22579628]
  66. Bloomer RH,Juenger TE,Symonds VV
    Natural variation in GL1 and its effects on trichome density in Arabidopsis thaliana.
    Mol. Ecol., 2012. 21(14): p. 3501-15
    [PMID:22625421]
  67. Yan A,Pan J,An L,Gan Y,Feng H
    The responses of trichome mutants to enhanced ultraviolet-B radiation in Arabidopsis thaliana.
    J. Photochem. Photobiol. B, Biol., 2012. 113: p. 29-35
    [PMID:22647943]
  68. Buschhaus C,Jetter R
    Composition and physiological function of the wax layers coating Arabidopsis leaves: β-amyrin negatively affects the intracuticular water barrier.
    Plant Physiol., 2012. 160(2): p. 1120-9
    [PMID:22885935]
  69. Li F,Zou Z,Yong HY,Kitashiba H,Nishio T
    Nucleotide sequence variation of GLABRA1 contributing to phenotypic variation of leaf hairiness in Brassicaceae vegetables.
    Theor. Appl. Genet., 2013. 126(5): p. 1227-36
    [PMID:23370467]
  70. Zhou Z, et al.
    Zinc Finger Protein 6 (ZFP6) regulates trichome initiation by integrating gibberellin and cytokinin signaling in Arabidopsis thaliana.
    New Phytol., 2013. 198(3): p. 699-708
    [PMID:23506479]
  71. Qi T,Song S,Xie D
    Modified bimolecular fluorescence complementation assay to study the inhibition of transcription complex formation by JAZ proteins.
    Methods Mol. Biol., 2013. 1011: p. 187-97
    [PMID:23615997]
  72. Wang G,Zhao GH,Jia YH,Du XM
    Identification and characterization of cotton genes involved in fuzz-fiber development.
    J Integr Plant Biol, 2013. 55(7): p. 619-30
    [PMID:23710824]
  73. Pesch M,Schulthei
    Mutual control of intracellular localisation of the patterning proteins AtMYC1, GL1 and TRY/CPC in Arabidopsis.
    Development, 2013. 140(16): p. 3456-67
    [PMID:23900543]
  74. Qi T, et al.
    Arabidopsis DELLA and JAZ proteins bind the WD-repeat/bHLH/MYB complex to modulate gibberellin and jasmonate signaling synergy.
    Plant Cell, 2014. 26(3): p. 1118-33
    [PMID:24659329]
  75. Liang G,He H,Li Y,Ai Q,Yu D
    MYB82 functions in regulation of trichome development in Arabidopsis.
    J. Exp. Bot., 2014. 65(12): p. 3215-23
    [PMID:24803498]
  76. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  77. Pesch M, et al.
    TRANSPARENT TESTA GLABRA1 and GLABRA1 Compete for Binding to GLABRA3 in Arabidopsis.
    Plant Physiol., 2015. 168(2): p. 584-97
    [PMID:25926482]
  78. Larkin JC,Oppenheimer DG,Marks MD
    The GL1 gene and the trichome developmental pathway in Arabidopsis thaliana.
    Results Probl Cell Differ, 1994. 20: p. 259-75
    [PMID:8036319]
  79. Esch JJ,Oppenheimer DG,Marks MD
    Characterization of a weak allele of the GL1 gene of Arabidopsis thaliana.
    Plant Mol. Biol., 1994. 24(1): p. 203-7
    [PMID:8111017]
  80. Szymanski DB,Jilk RA,Pollock SM,Marks MD
    Control of GL2 expression in Arabidopsis leaves and trichomes.
    Development, 1998. 125(7): p. 1161-71
    [PMID:9477315]
  81. Schnittger A,J
    Tissue layer and organ specificity of trichome formation are regulated by GLABRA1 and TRIPTYCHON in Arabidopsis.
    Development, 1998. 125(12): p. 2283-9
    [PMID:9584127]
  82. Szymanski DB,Klis DA,Larkin JC,Marks MD
    cot1: a regulator of Arabidopsis trichome initiation.
    Genetics, 1998. 149(2): p. 565-77
    [PMID:9611174]
  83. Perazza D,Vachon G,Herzog M
    Gibberellins promote trichome formation by Up-regulating GLABROUS1 in arabidopsis
    Plant Physiol., 1998. 117(2): p. 375-83
    [PMID:9625690]
  84. Shikazono N,Yokota Y,Tanaka A,Watanabe H,Tano S
    Molecular analysis of carbon ion-induced mutations in Arabidopsis thaliana.
    Genes Genet. Syst., 1998. 73(3): p. 173-9
    [PMID:9794081]
  85. Szymanski DB,Marks MD
    GLABROUS1 overexpression and TRIPTYCHON alter the cell cycle and trichome cell fate in Arabidopsis.
    Plant Cell, 1998. 10(12): p. 2047-62
    [PMID:9836744]